PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 498aa    MW: 57540.5 Da    PI: 9.6005
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613390.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.32.8e-3026109186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW++ e+laL+++r+em++++r++ lk+plWee+s+km+e g++rs+k+Ckek+en+ k++k++keg+ ++++++  t+++f++l+
  XP_013613390.1  26 RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKYHKRTKEGRTGKSEGK--TYRFFEELQ 109
                     8********************************************************************975544..6******98 PP

2trihelix1062.7e-33359444187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r+++e +++++  ++plWee+s  mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr + +s+tcpyf+qlea
  XP_013613390.1 359 RWPKTEVEALIRIRKNLEANYQENGTRGPLWEEISGGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKR-PLDSKTCPYFNQLEA 444
                     8*********************************************************************8.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0442385IPR001005SANT/Myb domain
CDDcd122031.13E-242590No hitNo description
PROSITE profilePS500907.0042583IPR017877Myb-like domain
PfamPF138371.9E-2025111No hitNo description
SMARTSM007170.011356418IPR001005SANT/Myb domain
PROSITE profilePS500907.387358416IPR017877Myb-like domain
PfamPF138379.5E-24358445No hitNo description
Gene3DG3DSA:1.10.10.606.2E-4358415IPR009057Homeodomain-like
CDDcd122033.43E-25359423No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MGGSGEDEKD MTMEEIGEVG GGGGNRWPRP ETLALLRIRS EMDKAFRDST LKAPLWEEIS  60
RKMMELGYKR SAKKCKEKFE NVYKYHKRTK EGRTGKSEGK TYRFFEELQA LEALNSYPPE  120
PESQPLKSST ATTTVTTTTS LIPLNHHQVS VKPIATKPTF QAKQPSPTTP FPIYSNNHAT  180
TIDTGFRPTS NDLINNVSSL NLFSSSTSSS TASDEEEDHH HQDKRSRKKK KYWKRLFTKL  240
TKELMAKQEK VQTRFLEIFE NQERERISRE EAWRVQEVAR INREHKTLVH ERSNAVAKDA  300
AIISFLHKIS GGQQQQPRQK HKVPQRKQYH SEHSITFESK EPRPVLFDSN HSLSPSSSRW  360
PKTEVEALIR IRKNLEANYQ ENGTRGPLWE EISGGMRRLG YNRSAKRCKE KWENINKYFK  420
KVKESNKKRP LDSKTCPYFN QLEALYNERN ESGALSILPL MLTPQLLPQQ TQTELKTDQG  480
DKGEEGESEE DDYENEDE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16876KRSAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0792831e-131AC079283.4 Arabidopsis thaliana chromosome 1 BAC F7O12 genomic sequence, complete sequence.
GenBankAK2277781e-131AK227778.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-35-A17.
GenBankAY0871171e-131AY087117.1 Arabidopsis thaliana clone 3190 mRNA, complete sequence.
GenBankBT0303631e-131BT030363.1 Arabidopsis thaliana At1g76890 mRNA, complete cds.
GenBankCP0026841e-131CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ1088311e-131DQ108831.1 Arabidopsis thaliana clone 27806 mRNA sequence.
GenBankX727801e-131X72780.1 A.thaliana mRNA for GT-2 factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613390.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391170.0TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D3AR460.0A0A0D3AR46_BRAOL; Uncharacterized protein
STRINGBra008286.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59952847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.20.0Trihelix family protein